PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj3g3v0668970.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 352aa    MW: 38885.4 Da    PI: 8.4307
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj3g3v0668970.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.92e-53161431128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeelvv+yLkkk+++ +l++  +i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+vl+
  Lj3g3v0668970.1  16 LPPGFRFHPTDEELVVHYLKKKAASVPLPV-AIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLT 108
                      79****************************.88***************988899**************************************99 PP

              NAM  95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + ++++vg+kk Lvfy g+ p+g kt+W+mheyrl
  Lj3g3v0668970.1 109 SnGTQKVGVKKALVFYGGKPPRGIKTNWIMHEYRL 143
                      867788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-6510177IPR003441NAC domain
PROSITE profilePS5100561.92516177IPR003441NAC domain
PfamPF023655.8E-2817143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009753Biological Processresponse to jasmonic acid
GO:0045995Biological Processregulation of embryonic development
GO:0048317Biological Processseed morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MESTDSSTGS QQQPNLPPGF RFHPTDEELV VHYLKKKAAS VPLPVAIIAE VDLYKFDPWE  60
LPAKATFGEQ EWYFFSPRDR KYPNGARPNR AATSGYWKAT GTDKPVLTSN GTQKVGVKKA  120
LVFYGGKPPR GIKTNWIMHE YRLADNKPNN RPPGCDLGNK KNSLRLDDWV LCRIYKKSNT  180
HRSPLEHERE ESMDDMIGGV PSSINVGHHM NSRLHLSKMS SSYTNSALLE NDHHLYEGMM  240
LSNGAICSAA NASSLSNSKA ELSNASKRTL SSLYWNEDDV AGTSSSNKRF DLDGSVGGGD  300
HHGSGIVRTD QENGTATSIA SLLNQLPQTP SLHQQTMLGS IPYQITGMNW YG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-75101799170Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00361DAPTransfer from AT3G15510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007149615.10.0hypothetical protein PHAVU_005G084600g
SwissprotQ9LD441e-117NAC56_ARATH; NAC transcription factor 56
TrEMBLV7BUF50.0V7BUF5_PHAVU; Uncharacterized protein
STRINGGLYMA13G35560.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-113NAC domain containing protein 2